Pages
- Best Laptops Deals April 2026
- Best Smart Watches April 2026
- Mobiles
- Amazon Deals & Offers for April 2025
- All Stores: List of Top Shopping Sites India
- Loot Deals
- Today Deals
- OFFER OF THE DAY
- New Deals
- Flipkart Sale Today Offer for 1st April 2026
- Home
- Best Mobiles Offers – Flipkart Big Billion Days Sale Deals 2026
- Sitemap
- Amazon Great Indian Festival Sale 2024: Best Mobile Offers
- Dealsoftheday
- test
- Amazon Prime Day Sale
- About us
- Privacy Policy
Deals
- Philips WiZ 10W E27 Wi-Fi & Bluetooth LED Smart Bulb with Music Sync, Compatible with Amazon Alexa & Google Assistant, 16 Million Colours & Motion Sensing Technology | Pack of 2
- Fiama Gel Bar Lemongrass And Jojoba, 375g (125g – Pack of 3), with Skin Conditioners for Smooth Skin, Bathing Soap for Women & Men, For All Skin Types
- ATTRO Hot-Meal 3 Insulated Lunch Box with 3 Compartment, Inner Stainless Steel & Locking Lid BPA-Free Food Grade Ideal for School, Office – 900ml Dark Blue
- Tata Tea Gold All-in-1 Instant Premix Cardamom Tea, 14g Per Serve, Quick & Easy To Make Cardamom Tea, 10 Sachets
- ATTRO Crunch Plastic Lunch Box Airtight, BPA-Free Comes with Fork & Spoon – Ideal for Office, School, Travel, Adults & Kids- Green- 900ml
- BSB HOME Premium Wool Blend Stripe Blanket | Soft, Warm & Lightweight Full Size Blanket | Red Stripes | 152 x 228 cm, 1800g, 500 GSM | Ideal for Winter & All Seasons
- Reebok Mens Fusion Lux 2.0 M Sneaker
- Portronics Car Power Armour 55.5W Fast Car Charger with Emergency Glass Breaker, 33W Type-C PD, 22.5W USB-A Port, LED Display for Voltage Monitoring, for Smartphones, iPhones, Tablets, Earbuds & More
- FEDUS Screen Cleaner Fluid Gel Multi-Purpose LCD Cleaning Kit, Liquid Solution with Cloth to Clean Mobile/Laptop Screen, Computer, Tab, LCD Display, Camera (100 ML)
- Cello Puro Steel-X Genx 600 | Inner Steel Bottle | PU Insulation | Cold Insulated Bottle | Best Usage for Office/School/College/Gym/Picnic/Home/Fridge | 540ml, Bright Yellow
- Lenovo Go Wireless Multi-Device Mouse | Connect & Switch: Upto 3 devices | Upto 2400 DPI | Rechargeable | Fast Charge (Upto 3 months in 1.5hrs) | Programmable | 75g ultra-light | 3Yr Exchange Warranty
- Colors Queen Affair Nail Polish – 10 – Moon Dance, 13ml | Rich Pigmentation, Quick Drying, Long Lasting Nail Paint | Chip Resistant, No Harmful Chemicals, Semi Matte Nail Polish for Women
- LG 24″ Inches Ultragear™ FHD IPS Gaming Monitor, 1ms (GtG), 180Hz, HDR10,FPS Counter, NVIDIA G-SYNC Compatible, AMD FreeSync, HDMI, DP, Headphone Out, virtually Borderless with Tilt, Black 24GS60F
- ATTRO My Cup Tumbler Plastic Water Bottle with Handle, BPA-Free, Leak-Proof, Ideal for School, Gym, Office, Travel & Daily Use – Pink- 1000ml
- Halonix Yellow 10W wall Lamp LED Oval Shape Outdoor Bulkhead | Outdoor light waterproof IP65 | Waterproof Porch Light for Outdoor Garden Bathroom Light (Warm White, Pack of 1)
- Crystal Medium Plastic Chopping Board, Multicolour
- Crossbeats RoadEye Neo| New Launch| 2K FHD+ Dash Cam for Car| WiFi APP Mic Loop Record| 170° Wide Angle Dashcam for Car|Rotating Cabin Camera| Night Vision| Supercapacitor Dash Camera 1TB (2025 Model)
- Ant Esports MP320C – Control Gaming Mouse Pad-XL-Extended Large with Stitched Edges, Waterproof Non-Slip Base for Gaming & Office – Black
- Dabur Cold Pressed 100% Pure Castor (Arandi) Oil – 400ml (Pack of 2 x 200ml) | Promotes Hair Growth, Hydrates Skin & Reduces Wrinkles | Rich in Vitamin E, Omega 6 & 9 | No Mineral Oil, No Hexane & No Added Silicones
- Soundcore Anker Rave Neo 2 Portable Speaker with 80W Stereo Sound,Partycast 2.0,Light Show,Ipx7 Waterproof(Floats On Water) 18H Playtime,Customizable Eq & Bass Up for Party,Backyard-Black,USB
- Milton Ascent Mixer Grinder, ISI Certified, Grindstone Blade Technology, 4 Jar, 800 W (22000 RPM), 5 yr motor warranty, 2 yr product warranty I Blue
- Philips Ujjwal 20-Watt LED Batten, Cool Day Light, 4 feet-Synthetic
- MILTON Graze Lunch Box, 2 Round Inner Steel Microwave Safe Containers 320 ml Each with Insulated Bag, Odour Proof, Tiffin for Office Men, Women, Leak-Proof Containers, Easy to Carry, Blue
- soundcore K20i by Anker, Semi-in-Ear Earbuds, Bluetooth Wireless, 36H Playtime, Fast Charge, Clear Sound, Comfortable Fit, ENC 2-Mic Clear Calls, Custom EQ, IPX5, Bluetooth 5.3, App Control
- Presto! Toilet Cleaner Bleach Disinfectant | 2 Litre | 1 L x 2 Packs | Kills 99.9% Germs | White
- JXL U700 Car Dash Cam | Full HD 1440p, 170° Wide Angle, 360° Rotation | WiFi, App Control | NTK96675 Chipset, G-Sensor | Card Support Up to 128GB | Loop Recording, Night Vision | Car Dash Camera Front
- Flawless (Best Suitable for 6.5 kg Samsung Washing Machine) Fully Plastic Mould and Metal Pipe Premium Heavy Duty Fully Top Load Washing Machine Stand/Trolley
- PHILIPS 20W Ujjwal LED Batten, LED Tubelight for Home, Cool Day Light, Pack of 2
- Dettol Skincare Body Wash and Shower Gel for Women and Men, 250ml | Soap-Free Bodywash | 8h Moisturization
- Rexona Roll-On Deodorant | Invisible Dry + Shower Clean Motion Activated Deo for Women | up to 72Hr Freshness | 45 ML each
- Aristocrat Liberty Set of 3 (Cabin+Medium+Large) Trolley Bag, 58+68+78Cm | Combination Lock | 8 Wheels | 3 Years International Warranty | New Saddle Brown
- Boat Aavante 2.0 150, 2.0 CH, 16W Signature Sound, RGB LEDs, Dual Full-Range Drivers, Upto 5H Battery, TWS, Multi Ports, Bluetooth Sound bar, Home Theatre Soundbar Speaker (Premium Black)
- Dabur Cold Pressed Groundnut Cooking Oil – 1L | Rich in antioxidants | Good for Heart health | Enriched with MUFA & OMEGA 6 PUFA | Aroma of Purity
- ALFA Hard Body Set of 2 Luggage 8 Wheels – Rhino 2 (Small 55cm| M…more
- Gits Cow Ghee 500 ml Jar | Pack of 1 | Aroma in every drop |Pure Veg, Pure Cow Ghee, Desi Ghee, No preservatives | Rich Taste & Aroma | Good source of Vitamin A, Delicious, Healthy & Nutritious | Good for Digestion, Heart, Skin and Hair | Homemade taste
- Dermicool Soap With The Power Of 3 Coolants – Camphor, Menthol, Thyme Oil | 99.9% Germ Protection | 125 GM Each | Pack of 3
- Philips Rally Pro H4 Headlight Bulb Set of 2, P43t 12V 100/90W | High Performance Super Bright and Durable Halogen Light Bulbs for Car
- DABUR Gluco-C Instant Powder Energy Glucose (Mango Flavour) – 1Kg | Replenishes Energy | 20% More Glucose In Every Sip | Vitamin C Helps Boosts Immunity | Calcium Supports Bone Health
- Spinz Set Of 2 Enchante & Blue Bounce Perfumed Deodorant- 200ml Each
- Larah by Borosil Rose Red Silk Series Opalware Dinner Set | 27 Pieces for Family of 6 | Microwave & Dishwasher Safe | Bone-Ash Free | Crockery Set for Dining & Gifting | Plates & Bowls | White
- Gillette Mach 3, Shaving Razor For Men | Most Comfortable Shave | 3D Blade Technology | Metal Handle For Superior Grip
- TRIGGR Trinity 3 with Fabric Finish, Dual Pairing, 50H Battery, F…more
- ZEBRONICS Panther Ambidextrous Optical Mouse 1600DPI, Silent Ergo…more
- Buds X Truly Wireless in Ear Earbuds with 32H Playtime, AI-ENC Mic, 35ms Low Latency Game Mode, 13mm Bass Drivers, Type-C Fast Charging, Made in India, Touch Controls, IPX5 Ear Buds TWS (Black)
- Croma TWS Earbuds with Environmental Noise Cancellation (IPX4 Water Resistant, Fast Charging, Grey Blue)
- Gillette Fusion 5, Shaving Razor For Men | With Beard Shaping Back Blade | 5 Blades For Your Perfect Shave | Styling Back Blade For Your Perfect Beard Shape
- Tresemme Set of 3 Keratin & Argan Oil Shampoo 580ml + Conditioner 190ml + Serum 50ml
- Surf Excel Matic Top Load Liquid Detergent 5L Refill Pouch, Specially designed to remove Tough Dried Stains, 1st time in Washing Machine
- Zebronics Compact Soundbar, 18 Watts, Upto 6 Hours Playback, Dual 52mm Drivers, Dual Passive Radiators, TWS, Type-C Charging, USB, AUX, LED Indicator (Vita Bar 202)
- Zebronics 2026 Launch 140W Soundbar with 13.3cm subwoofer, Dual Drivers, Dolby Audio, Bluetooth v5.4, ARC, USB, Optical in, AUX, LED Display, Volume & Media Control, Matte Finish (Juke Bar 9010C)
- Zebronics Wireless Bluetooth Soundbar, 26 Watts, Upto 7 Hours Playback, Dual 52mm Drivers, Dual Passive Radiators, LED Indicator, TWS, Fabric Finish, Type-C Charging, USB, AUX (Vita Bar 203)
- SG Club Wicket Keeping Gloves Boys/Junior Size
- Presto! Ultra Strong Disinfectant Toilet Cleaner 3L | 1L X Pack of 3 | Ocean Mist
- Presto! Ultra Strong Disinfectant Toilet Cleaner 1L | Ocean Mist
- Gulf FORMULA SUV 5W40 API SP, ACEA A3/B4|75% Superior Wear Protec…more
- ESSON Radiator Coolant Fully Synthetic Car Care Concentrate (1L x…more
- Castrol EDGE 0W-40 Advanced Full Synthetic Engine Oil for Cars | …more
- Boat Rockerz 255 Pro+, 60H Battery, Fast Charge, IPX7, Dual Pair,Low Latency,Magnetic Buds, Stream Ad Free Music via App Support, in Ear Bluetooth Neckband, Wireless with Mic Earphones (Cosmic Grey)
- 2-in-1 Hair Straightener & Curler Brush with Built-in Comb | Fast Heating Hair Styling Iron | 6 Temperature Settings | Anti-Scald Safe Design | Portable Hair Styler for Home & Travel
- Cafe Coffee Day – Refresh 200 Gms | Filter 60% Coffee & 40% Chicory, Medium To Dark Roast | South Indian Filter | Freshly Roasted Ground – Bag
- Zebronics Wireless Bluetooth Soundbar, 42 Watts, Upto 7h Playback, Dual 57mm Drivers, Dual Passive Radiators, TWS, Call Function, Type-C Charging, USB, AUX (Vita Bar 301)
- amazon basics in-Ear Wired Earphones with 9 mm Dual Drivers, in-Line Mic, Powerful Bass, Noise Isolation, 3.5 mm Audio Jack (Black and Red)
- Bikano Bombay Mixture | Spicy & Tangy Indian Namkeen Snack | Crunchy Blend of Sev, Peanuts & Spices | Tea-Time Snack – 800g
- E-20 Alcohol Breath Tester | Professional Digital Breathalyser with LCD Display | High-Precision Alcohol Detector | 5 Replaceable Mouthpieces | Sound Beep Alert | Personal & Professional Use
- Pigeon 14-Litre Oven Toaster Grill (OTG) (19004365, Black)
- Sturlite Eva 3W LED Spotlight| 3000K Warm White Color Temperature| 36mm-Cutout & Compact Design Ceiling Ligh| CRI Tech with High Voltage Protection Downlight – Pack of 10
- Parachute Advansed Soft Touch Body Lotion for Women & Men, All Skin types, 225ml | Pure Coconut Milk & Honey, 100% Natural, 72h Moisturisation
- Wet n Wild Megalast Retractable Eyeliner, Black Brown, 0.23 g
- Pack of 20 Heart Balloons for Happy Birthday Decoration Gold Kit Baby Boys Girls Kids Men Women Car Boot Living Room Heart Shaped Foil Balloon Set Items Golden
- Mattress Vacuum Cleaner, Handheld Bed Vacuum with Powerful Suction,Lightweight and Rechargeable Sofa Cleaner, Effectively Clean Up for Pillows, Sheets, Mattresses, Sofas, Bed, Car Home
- TRIGGR Kraken X1 with Battery Display, 40ms Latency, Quad Mic ENC…more
- Boldfit Gym Vests for Men Workout Breathable Vest for man Lightweight Sleeveless t Shirts for Men Regular fit Gym Vest for man Round Neck Tank top Boys
- Bumtum Baby Gentle 99% Pure Water Soft Moisturizing Wet Wipes wit…more
- Bumtum Baby Chota Bheem Gentle Wet Wipes With Lid | Aloe Vera & C…more
- WROGN Trekking Bag For Hiking/Camping/Outdoor Sports with Rain Co…more
- Vector X Cyrus Stockings | Polyester Stretchable Material | Knee Length | Unisex Pack of 1 Pair
- The Indian Garage Co Men’s Slim Fit Mid Rise Vertical Striped Mid-Rise Chinos
- ArrowMax 100% Silicone Anti Fog Swimming Goggles,Cap,Earplug & Noseplug Set- Ideal for All Age Group | Silicone Non Slip | Easy to Carry and Skin Friendly- by Arrowmax (Blue)
- Egg Boiler Electric Automatic Off 7 Egg Poacher For Steaming, Cooking, Boiling And Frying, (350 Watts,Multicolor)
- LOTUS HERBALS WhiteGlow Skin Brightening Deep Moisturising Cream …more
- Aryanveda Aloe Vera Glycerine Bathing Soap 125g (Pack of 10) | Natural Hydrating & Moisturizing Body Cleanser for Soft, Glowing Skin | For Women & Men | All Skin Types
- Boldfit Weight Machine for Home Digital Weighing Machine for Human Body with LCD Display Max Weight Capacity 180Kgs (Batteries Not Included) – Bathroom Scale for Home
- Ambrane Type C to Lightning Fast Charging Cable Compatible with iPhone 14/14 Pro/ 14 Pro Max/ 13/13 Pro/ 13 ProMax/ 12/11/XR/XS/X/8 all Series ( ABTL Black)
- Shades Classic Slip-On Formal Shoes for Men | Comfortable Walking Shoes | Classic Design | Soft Lining | Breathable | Slip Resistant
- 3-Sided Toothbrush with U-Shaped Triple Head Design, Dual Bristle Arrangement, Curved Brush Head, Ergonomic Handle with Non-Slip Grip, Multi-Color Toothbrush Set (Pack of__1)
- Cetaphil Gentle Exfoliating SA Lotion 29ml | Lightweight Daily Moisturizer with Salicylic Acid, Mandelic Acid & Gluconolactone | 48 Hr Hydration & Gentle Exfoliation | For Sensitive Skin
- Del Monte Whole Wheat Penne Pasta, 500g | 100% Whole Wheat | Healthy Pasta – No Maida | Gourmet Pasta | High Protein & Fibre | 100% Vegetarian, 0% Cholesterol & Trans Fat
- THE CLOWNFISH Boys Polyester Shower Saver Series Unisex Kids Waterproof Single Layer Pvc Standard Length Longcoat/Raincoat With Adjustable Hood.
- ROTZ Stainless Steel Scrub Scratch Proof Kitchen Utensil Dish wash, Steel Scrubber Pad (Standard, Pack of 6)
- Nutrabay Pure Series Micronised Creatine Powder Monohydrate, Pre/Post Workout Bodybuilding, Crossfit Supplement, 250 g (Unflavoured)
- Portronics Power Plate 12 Extension Board with 4 Universal Sockets, 2 Meter Long Cord, 1500 Watt, Fireproof Material, Multi Plug for Home Appliances (Black)
- CORATED Aluminium Sunset Lamp, Projector Sunset Light 180 Degree Rotation Projection LED Night Light for Photography(Sunset Red) Pack of 1
- ARCK 2 in 1 Soap Dispenser for Bathroom Accessories Dishwasher Liquid Holder Liquid Dispenser Pump 400 ML with Sponge Holder Kitchen Sink Accessories Items (Multi-Color, Pack of 1)
- Fastrack Tees Café Analog Brown Dial Women’s Watch-68021PP01W
- Eitheo Wooden Piggy Bank | 1 Lakh Money Saving Box with Numbers | Money Saving Challenge Box | Wood Money Bank for Adults & Kids | Cash Box | Savings Box with Counter | Money Treasure Box
- Women’s Linen Button-Down Shirt and Shorts Set, Cream with Green Tribal Print, Half Sleeve
- Lloyd 1.5 Ton 3 Star Inverter Split AC (6 in 1 Convertible, Cools Even at 52°C, Copper, Anti-Viral + PM 2.5 Filter, White, GLS18I3FWGSC)
- Happy Harvest Afghani Anjeer | Rich in Fiber & Nutrients | Perfec…more
- Glory Sarees Women’s Banarasi Silk Saree With Blouse Piece (Kara146_Parent)
- OZiva Collagen Builder for Anti-Ageing & Skin Radiance with Vitam…more
- BSB HOME Glow in The Dark Kids Blanket, Soft Flannel Fleece Luminous Blanket for Boys & Girls, Cozy Lightweight Kids Throw for Bed – 30 x 40 in (76 x 102 cm) (Game On Theme – Light Grey)
- Wildcraft 4×4 Off Road 25 L Duffle Bag for Men & Women | Multiple Pockets, Adjustable Straps | Travel, Gym & Sports Bag | Black
- Maharaja Whiteline 500W Livo Pro Mixer Grinder with 3 Stainless Steel Jars with lid and 20,000 RPM Motor Speed (White & Cherry Red)
- Wesley Carnival Hard-Sided Polypropylene Carry-on Trolley Bag | 55cm Small-Cabin | 360° 8-Wheel Easy Drag | Combination Lock | Luggage Bag
- ZEBRONICS Zeb-Jaguar Wireless Mouse, 2.4GHz with USB Nano Receiver, High Precision Optical Tracking, 4 Buttons, Plug & Play, Ambidextrous, for PC/Mac/Laptop (White+Grey)
- Solimo Royal Multipurpose Storage Basket With Lid- Medium (Set Of 3, Brown), Rectangular, Rattan
- amazon basics Bathroom Organizer Without Drill | Wall Mounted Bathroom Shelves & Rack for Modern Space Saving Storage Pack of 2
- Nike Female Honey + Musk Spray Deodorant For Woman- Pack Of 2 (200Ml Each), 2 Count
- Savlon Moisturizing Glycerin soap bar with germ protection, Pack of 5-120g each
- KOLORR Jolly Plastic Small Basket with Handle for Storage Box| Multipurpose Light Weight Plastic Baskets organiser for Clothes Toys Stationary Cosmetics Livingroom Bathroom | Pack of 2 – Nir White
- Lifelong Sleeping Bag for Adults – Winter Sleeping Bags Certified for Temperatures 4°C to 10°C – Mummy Shape Foldable Camping Bed Height Upto 6’5”feet – Travel Accessory for Camping, Hiking, Trekking
- Crompton Immensa 9W Bluetooth Enabled Smart Bulb B22 | 16 million Colours | White Tunable (Warm, Neutral & Cool White) & Dimmable | App-Control |Music Sync|Perfect light for all occasions|Pack of 1
- boAt Airdopes Ace TWS in Ear Earbuds with 35 HRS Playback, 13mm Drivers, Dual Mics ENx & Beast Mode(Active Black)
- Portronics Magma Lite Type-C Powered Humidifier with RGB Light, 260ml Water Tank, 35ml/h Mist Output, Continuous & Intermittent Modes, One-Button Control, for Home, Car & Bedside (Water Use Only)
- PHILIPS 4-watt Filament Candle LED Bulb | Filament Candle Bulb Home & Decoration|Bulb Base: E14, Color: Warm White|Pack of 1
- Boys Winter Wear Regular Fit Hooded Neck Sweatshirt with Long Sleeves and Standard Length
- Lakmé Dry Matte Fluid Sunscreen SPF 50 PA++++ | Barrier Repair & Healthy Glow| Niacinamide and 1% Ceramides | For Oily & Combination Skin | In-Vivo Tested | No White Cast | 50 ml
- Kalyani Emy Pack Of 6 Mid-Rise Anti-Odour Hipster Briefs
- Acer ED270U S3 27 Inch WQHD 2560×1440 1500R Curved Gaming Backlit LED LCD Monitor I 1MS VRB, 180Hz Refresh Rate I AMD FreeSync I 2 x HDMI 1 x Display Port I Stereo speakers I Eye Care I HDR 10 I Black
- Kalyani Sharon Padded Seamless Cups with Transparent Straps Everyday T-Shirt Bra
- K Lingerie Pack of 3 Manvi Wirefree Cotton Everyday Bra
- Highlander Mens Tapered Fit Denim Jeans|Jeans for Man Regular Length|Distressed Jeans |Mid-Rise|Stylish Casual Wear with Stretchable Fabric for Everyday Comfort
- Fastrack Tees Quartz Grey Dial Grey Silicone Strap Unisex Analog …more
- Washing Machine Cleaner Tablets (16 Tablets) | Drum & Pipe Deep Cleaner | Lavender Scent | Removes Odour, Limescale & Residue | For Front Load & Top Load Fully Automatic Washing Machines
- Spotzero By Milton Non-Scratch Wire Dish Cloth (Pack of 6) I Multipurpose Scrubber for Kitchen Utensils, Sinks, Counter & More I Wet and Dry Cleaning for Kitchen & Home
- PANCA Plastic Kitchen Dish Rack Organizer with Drying Tray | Durable Utensil Drainer Basket for Plates, Bowls & Spoons | Countertop Storage Stand (Green & Brown, 45 x 32 x 18 cm)
- Lakme Perfect Radiance Serum 30 ml
- SINGER Electric Airfrio Air Fryer 1350W | 4.4L Basket | 100% Oil-Free Cooking | Digital Display | 10-in-1 Functions | 360° High-Speed Air Circulation | ISI Certified | 2 Years Warranty
- 40th Birthday Decoration items for Girls with Black and Pink Balloons, Black Happy Birthday Banner, Pink Foil Curtain, Foil Balloon number 40
- C & E (Cables & Etc® Pure Copper 3.5mm Stereo Audio Extension Cable Male Female Connectors with Zinc Alloy Metal Plugs Cable [ 2 Pack] [ 1.5Feet, [ 0.5 Meters]
- METRONAUT Small Cabin Suitcase (53 cm) 4 Wheels – Grid – Red
- KBS Door Gap Filler Bottom Sealing Strip Guard (Pack of 1) Rubber Stopper Sealer Sound,Dust and Weather Proof Noise Stopper Protector Fom Insect Strong Self Adhesive Home Kitchen Office Accessories
- Godrej aer Matic Kit – Automatic Air Freshener spray with Flexi Control | Cool Surf Blue (210ml)
- BELLAVITA C-Glow Vitamin C Face Wash with CICA & Green Tea | Bright & Glowing Skin | Reducing Dullness | All Skin Types | pH Balanced | Brightening Formula for Men and Women | 100 ml
- Megatron Family Pack of 9 Pieces, Daily Use Utility Vanity Cases with Set of 3 Duffle Bag & Set of 3 Suitcase, 100% Polycarbonate with 3-Years Warranty, 8 Wheels with Number Lock
- FRONTECH Neoband Wireless Neckband Earphones | 200Mah | 24Hrs Playtime | 10mm Deep Bass Drivers | Type-C Fast Charging (EF-0093)
- The Indian Garage Co Men Regular Fit Solid Bomber Jackets
- HIT Anti Mosquito Racquet Rechargeable Insect Killer Bat with LED Light
- Dettol 5 in 1 Washing Machine Cleaner & Descaling Liquid for top load and front load| Lemon 250ml | Removes Limescale, Dirt and Bad odour | Kills 99.9%* Bacteria | Pack of 2
- Crompton Dyna Ray LED Bulb | 5W | Cool Day Light | B22 Base | 180 Degree Coverage | 4kV Surge Protection | 440V High Voltage Protection | Pack of 2
- CALANDIS Foldable Rain Barrel Portable Water Storage Tank for Outdoor Camping Garden 200L
- LUMINOUS 48 Months Warranty Tubular Inverter Battery (180 Ah, AMP…more
- Whirlpol Descale Compatiable For Whirlpool Scalegon Washing Machine Front Load And Top Load, Cleaning Powder, Descaler Powder, Drum Cleaner 100 G Each (Pack Of 3)
- Pigeon 2-in-1 Baby Shampoo For Cleansing & Conditioning, Enriched With Avocado Oil & Marshmallow Extract, Parabens Frew, SLS & SLES Free – 200 ml
- Crompton Star Lord JB Pro LED Downlighter 3W Round LED Ceiling Light (Blue, Pack of 1)
- Puma Men Lite Pro Sneaker
- Lifelong Leg & Foot Massager Machine for Pain Relief | Foot, Calf & Leg Massager with Vibration, Rolling & Kneading Modes for Muscle Relaxation & Blood Circulation | Men & Women (LLM144)
- Fire-Boltt Ninja Call Pro Max Ultra Bluetooth Calling Smart Watch, 2.01″ HD Display, 120+ Sports Modes, Health Suite, AI Voice Assistance, SpO2 Smartwatch for Men & Women – Silver Link
- Durafit91 Compact Lite 2.5HP Peak BLDC Motor Walkpad Treadmill with Remote Control | 120 kg User Capacity Walking Pad| 6 km/h Max Speed | LED Display with Under-Desk Design | Home Use
- Dettol Body Wash and Shower Gel for Women and Men, Lavender Fresh- 250ml | | 8hr long lasting fragrance
Offers
- Amazon Great Indian Festival Sale 2025 : Deals Discount + Banks & Card Offers
- Flipkart Big Billion Days 2025: BBD Sale Date and Offers
- Sulfar 100% Waterproof Car Body Cover Compatible with Mirror for Tata Nano (Triple Stitched, Full Bottom Elastic, Blue-TB)
- Home Bacchat Pass (3 Months)
- Woverse Pro-Aging Serum | Boosts Collagen, Tightens Jawline, Reduce Wrinkles, Instant Plump | Hyaluronic Acid, 3% Multi-Peptides & Sarcoslim | 15ml
- DURACELL Specialty CR2032 Lithium Coin 3V Battery (Pack of 5)
- Women’s Dress Starts From Rs.270
- Miduty Liposomal Vitamin C Supplement Bioavailability, Antioxidant Vitamin, Skin Rejuvenation & Immunity Booster Body Detoxification – Zeal Technology – 6 Capsules
- Miduty Liposomal NMN 85% Highly Stable 400 mg Supplement | Nicotinamide Mononucleotide for Anti-Aging, NAD+ Support & Cellular Health | NMN Capsules with Resveratrol | 6 Capsules
- Miduty Complete Turmeric Matrix with Curcumin | Helps is Muscle & Joint, Lowers Cholesterol, Anti-Inflammatory, Boosts Memory & Skin Health | 6 Veg Capsules
- Godrej aer Spray | Room Freshener for Home & Office – Jasmine Delight (220 ml) | Long-Lasting Fragrance
- Women Kurta Below @199
- Applicable on all Fashion products Buy Fashion Pass only at Re 1 and get Flat discount of Rs 100 (Till 30th September, 2025)
- Big Billion Day Pass Applicable on all Fashion products Buy Fashion Pass only at Re 1 and get Flat discount of Rs 100 (Till 30th September, 2025)
- 70% Off On Bata Shoe.
- Miduty Vitamin B12 – Active Methylcobalamin – Bioactive B-Complex with B6, B9, B12 – Triple Power Punch Formula for Energy, Mood, Brain & Nerve Support – Fast Absorbing Chewable – 6 Veg Tablets
- Bombay Shaving Company Perfume For Unisex| Tokyo Premium Fragrances For Men 100ml | Fresh & Soothing Fragrance Xtremo Scent For Men, Eau De Parfum |Pack of 1
- Nivea Cream For Help Your Skin To Become Soft And Smooth (Normal Skin) 30ml
- Milton Kiddo 300 Thermosteel Vacuum Insulated Water Bottle with Spout Lid and Straw, 1 Piece, 275 ml, Blue, Easy Grip, Leak Proof, Hot or Cold, School, Travel Bottle, Sipper Bottle for Kids
- Curtains From 76
- DOMS Non-Toxic Extra Long Wax Crayon Set in Cardboard Box (24 Assorted Shades x 3 Set)
- Upto 86% Off On The Souled Store Clothing.
- The Indian Garage Co Men Slim Jackets Starts From Rs.461
- The Rise of the Iron Moon
- High Star Clothing at 85% Off
- Sonata Play Black Dial Watch for Women-NS87050NM02
- Allen Cooper Shirts Upto 71% Off
- TE-A-ME Classic Assam Teabags 100 Pcs | Tea Bags 100 | Assam Tea Bags
- IFB 2025 Model Silver Plus Smart Series 1 Ton 3 Star In-built Wifi Split AC with HD Compressor, AI, Dual Gold Fin & 8-in-1 Flexi Mode – White (CI133SL11SGM1, Copper Condenser)
- AKA CHIC Women’s Slim Jeans Starts from Rs.299
- SWAGR Socks Start from Rs.99
- MILTON Elate 750 Stainless Steel Water Bottle 635 ml, Single Walled, ISI Certified I Leak Proof Lid, Rust Proof I For School, Office, Gym I Silver
- Upto 90% off on RN Single Lever Exposed Part Kit
- Women’s Jeans Starts at 299
- Treo by Milton Glare Mug, 240 ml, Set of 2, Purple
- Upto 80% Off On VIP Innerwear
- Centuary Mattresses Lotus 4-inch Double Size Natural Back Support Antimicrobial Foam Quilted Rubberised Coir Mattress (72x48x4)
- Centuary Mattresses Sleepables 6-Inch Single Size with Active Edge Support Antimicrobial Foam Rolled & Vaccumed Bonnell Spring Mattress (72x36x6)
- Bajaj Pulsar 125 Neon Disc Motorcycle/Motorbike – Ebony Black With Platinum Silver Decals – Ex-Showroom
- Centuary Mattresses Sleepables 6-Inch King Size with Active Edge Support Antimicrobial Foam Rolled & Vaccumed Bonnell Spring Mattress (78x72x6)
- Upto 80% Off On Reebok Cloting
- Kook N Keech Graphic Print Drop-Shoulder Sleeves Pure Cotton T-shirt
- Flat 49 Store
- DIET GEAR Energy Drink – 10 litre Zero Sugar, Zero Caffeine Electrolytes 40 Effervescent Servings | with added 7 Essential Electrolyte Salts (Na, K, Mg, Ca, Cl, Zn, SO4) + Vitamin C | Lemon Flavor
- Spotzero by Milton Dust Removal Brush General Cleaning Daily Duster, Flexible Bristles, All Purpose Dusting Brush for Carpet, Keyboard, Home, Hotel and Household – Pack of 1 (Aqua Green)
- Premium Kid’s Clothing Set @479
- Act II Golden Sizzle Popcorn, 38g (30g with Free 8g)/35g (30g with Free 5g)
- Upto 75% Off On Spykar Clothing
- Costar Bluetooth Wireless Game Mode| Type-C| IPX4 Waterproof| Voice Assistant Black
- Puma Clothing @ 80% off
Quiz
- Which of these players retired from tennis after the 2024 Vienna Open?
- Who became the first Indian woman to score 50 international goals in 2024?
- “Semper Supra,” meaning “Always Above,” is the motto of which U.S. Armed Force?
- The latest venue in Test cricket is the Civil Service Cricket Ground in which city?
- Which of these sportspeople would be one of the flagbearers for the USA at the 2024 Paris Olympics?
- Who beat Novak Djokovic in the final to win his 2nd consecutive Wimbledon men’s singles title?
- Complete the title of this 2024 film: “Chhota Bheem and the Curse of .
- As per Guinness World Records, which national flag is the world’s oldest and longest-running flag?
- The iconic Air India building at Nariman Point was handed over to which state government?
- Which film is based on Mstyslav Chernov’s daily news dispatches and personal footage of his own country at war?
- Which state in Australia has chosen not to be the host of the 2026 Commonwealth Games?
- In 2023, which Spanish player created history by winning his first Wimbledon title?
- Who became the 17th Indian to score a century in Test debut?
- Who scored a half century in just 15 balls in a losing effort against Sunrisers Hyderabad in IPL 2024 for Delhi Capitals?
- Which team did Real Madrid beat on penalties in the quarter finals of the 2023-24 UEFA Champions League?
- Which Indian won the silver medal in the FIDE women’s candidates 2024?
- Which of these recently played ATP events has a court named after the legendary tennis player Rafael Nadal?
- Which of these players won the Monte Carlo Masters tennis tournament in 2024, his 3rd triumph in that event in 4 years?
- National Rifle Association of India is associated with which sport?
- What name is given to the world’s fastest humanoid robot developed by the Chinese company Robot Era?
- The 2009 Fair Pay Act in the USA is named after which former Goodyear employee who sued for pay discrimination
- Amazon FunZone Quiz Answers Today – 1st April 2026
- What is the name of the mascot of the 2024 Paris Olympics?
- Achanta Sharath Kamal represents India in which sport?
- Against which team did Sunrisers Hyderabad set a new record scoring 287 in an IPL match?
- Ligue 1 is the top national league in which country?
- Which of these batters scored a century during India’s recent 5 match T20I series against Zimbabwe?
- Who was the top scorer for India in the T20 World Cup final 2024?
- In 2024, who became the youngest person to win two Oscars?
- Which director won his first directing Oscar in 2024?
- In which state capital was the yearly Bonalu Festival held?
- Which organisation recently released the National Multidimensional Poverty Index?
- The armies of India and which country participated in the joint military exercise ‘Nomadic Elephant-23’?
- Amazon Sunday Wheel of Fortune Quiz
- Samsung Galaxy M17 5G Amazon Quiz Watch and win Up To Rs. 5000 Amazon Pay Balance
- Amazon Funzone Diwali Special Games Quiz (Chance to win ₹10/20 & more)
- Which team recently set the record for the highest chase in Indian Premier League history by successfully chasing a target of 262?
- IIT Delhi is going to set up its first Global Campus in which country?
- In June 2023, Egypt honored PM Modi with its highest honor ‘Order of the _____’.
- Jio Convention Centre in which city hosted the 71st finale of the Miss World paegent?
- Park Plus Quiz Answers 1st April 2026 – Play & Win Free Petrol
- The first match of the 2025 ICC Champions Trophy would be played between Pakistan and which team?
- Which iconic 1989 military drama series starring Shah Rukh Khan is being remade with Gauahar Khan and Vicky Jain in the lead?
- Justin who recently scored a hat-trick for Bournemouth against Newcastle, is the son of which famous footballer?
- Who had an upset victory over Coco Gauff in the quarter final of the 2025 Australian Open
- Who was the Player of the Match in the first Test played between Pakistan and West Indies in 2025?
- By what Indian name is the Indian roller bird commonly known
- The first T20I of the India vs England series in 2025 was played in which famous ground.
- In the 2025 Indian Premier League season, who among these would become the first Indian to be a full time captain for 3 IPL franchises?
- As per an order by the Supreme Court who would be selected by the PM, the Oppn Leader, and the CJI?
- In August 2023, which Italian World Heritage Site celebrated its 850th birthday?
- The Kerala Assembly recently passed a resolution urging the Centre to rename the state as what?
- Italy’s football authorities banned the use of which number on jerseys due to its association with the Nazi slogan ‘Heil Hitler’?
- After 38 years as Prime Minister of which country did Hun Sen announce to step down in 2023?
- In MP’s Kuno Park, what prey is taking up more bite power from the Cheetahs?
- Sabyasachi made masks of what for King Charles and Queen Camilla’s Animal Ball in 2023?
- Amazon Smart Business Owners Quiz Answers
- Amazon Women’s Day Special Quiz Answers: Win ₹15,000
- Amazon Women’s Day Pictionary Quiz: Win ₹10,000
- Vivo V50 Quiz Answers: Win ₹50,000 Amazon Pay Balance
- Which famous badminton player is one of India’s flagbearers for the 2024 Paris Olympics?
- Fatma Samoura became the first woman, first Black person, first non-European to be which organisation’s secretary general?
- The Tata Steel Chess tournament played in the classical format is being held in which country?
- Which of these West Indies bowlers took the wicket of Steve Smith with his first ball in Test cricket?
- Recently which of these New Zealand batters equalled the record for most sixes in a T20I innings?
- Which former champion did Caroline Garcia knock out in the first round of the 2024 Australian Open?
- Amazon FZ Runs Daily Quiz Answers 1st April 2026
- Amazon Thunder Wheels Quiz Answers
- Before Sumit Nagal, who was the last Indian to beat a seeded player at a Grand Slam in singles?
- Which of these places hosted the first T20I between India and Afghanistan in 2024?
- Who was named the vice captain of the Indian team for the T20 World Cup 2024?
- Who is the head coach of Bayer Leverkusen, winners of the Bundesliga this season?
- The Los Angeles Lakers were eliminated by which team, the defending champions, in Round 1 of the NBA playoffs?
- The Estadio Manolo Santana and the Estadio Arantxa Sanchez Vicario are courts used for which ATP Masters series event?
- Which team swept the Phoenix Suns 4-0 in the first round of the 2023-24 NBA Playoffs?
- The Bharat Ratna Shri Atal Bihari Vajpayee Ekana Cricket Stadium is the home ground of which IPL team?
- Which actor, best known for his work as Pee-wee Herman, passed away in 2023?
- Now shut down, which has been America’s oldest craft brewer with 127 years in business?
- What name did the Italian Meteorological Society give to the ongoing European heatwaves, inspired by a mythical monster?
- The 74th NATO Summit was hosted by which country?
- As of 2023, what household items are officially banned from being manufactured and sold in the U.S.?
- In July 2023, which country’s PM did President Joe Biden host at the White House to show support for their NATO bid?
- Which mercenary group supposedly takes its name from the radio call sign of its first field commander?
- Who is the first and only female professional sumo wrestler from India?
- Which Indian brand set a Guinness World Record with a 123-foot dosa to celebrate their 100th anniversary?
- Amazon Tecno Pop 9 Quiz Answers win Rs.5000
- Narzo is a new brand of Android smartphone developed by which Chinese manufacturer
- The Jeddah Corniche Circuit is home to which Grand Prix?
- India’s first underwater river tunnel for metro was constructed under which river?
- India’s newest airline Fly91 is based out of which state?
- What cricket rule, introduced in 2024, requires the fielding side to start an over within 60 seconds of the previous one?
- Which Indian won the 2023 International Emmy for Comedy?
- Who among these won Nobel Prizes for both Peace and Chemistry
- On which author’s semi-autobiographical work was the television series “Ek Tha Rusty” was based on?
- Which film won the Best Film- Musical or Comedy at the Golden Globes in 2024?
- The Black Nunia rice which recently got a GI tag is from which state?
- Who won the 2023 Australian Open Men’s Single Title?
- Who recently became the first Indian woman Arjuna Awardee for Equestrian Sports?
- Amazon Great Indian Festival Quiz Answers
- Who is the new Prime Minister of France?
Freebies
- Free Sample of Hairshield Anti Lice Cream Wash
- Free Sample Kits: Pedigree Pro
- Get Free Zepto pass for 2 months
- Get Your Free Breast Self-Exam Kit from SBI Life
- Free 6 Months Pharmeasy Plus Membership at Worth ₹399
- Get Free Samples of Parachute Baby Advansed Products Now!
Stores
- adidasadityabirlacapitalairasiaAjioAmazonapollo247appleaubankbajajfinservbatabbdailyBeardobhimbhimupibigbasketbingopromoblinkitboatbolttbombayshavingcompanybookmyshowbuykarobuywowc (90w)| deltaechaayoscinepoliscleartripcloviacreativecredcrocscromacromafreshdistrictdmartDomino'sdroomeazydinerelementsepicgamesfindroyalcaninfirebolttfirstcryfitspireFlipkartfreechargegharsoapsgizmoregncgonoisegooglegovipgpaygyftrhappilohavells active plus water purifier with uv+revitalizer purification technology, powerful 4 stage purification, smart alerts with auto –energy saver, (green and white), suitable for tdshavells fab uv storage water purifier (white & green), uv+uf, copper+zinc, 5 stage purification, 7l tank, suitable tdshdfcbankhypdicicibankinoxmoviesitcstorejackjonesjiojiomartkfckotakkukufmlavamobileslenskartliciouslifestylelouisphilippelut,deltaemagicpinmakemytripmcaffeinemedibuddymimicrosoftmobikwikmoneycontrolmuscleblazeMyntramytoddlernature4naturenetmedsnoisenykaanykaafashiononeplusottplayoxyglowozivaParachute AdvansedparkplusParkPluspaytmPaytmMallpayzappPedigreepepperfrypharmeasyplumgoodnessprimevideopumapvrpvrcinemasrealmeredbusredrailreliancedigitalrupaysamsungsbishopsysnapdealspicebucketspotifyswiggyTata CLiQtatadigitaltataplaythemancompanytitanuandiworldubervanheusenindiavijaysalesvodafonewatchowforwomanwildcraftwoodlandwoodlandworldwidewoohoowowwowskinscienceindiaxiaomixyxxcrewyatrazanducarezeptoZeptoNowzivamezofffoodszomato